Lineage for d1e5pc_ (1e5p C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. Protein Aphrodisin, a sex pheromone [63805] (1 species)
  7. Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [63806] (1 PDB entry)
  8. Domain d1e5pc_: 1e5p C: [59274]

Details for d1e5pc_

PDB Entry: 1e5p (more details), 1.6300000000000001 Å

PDB Description: crystal structure of aphrodisin, a sex pheromone from female hamster
PDB Compounds: (C:) aphrodisin

SCOPe Domain Sequences for d1e5pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5pc_ b.60.1.1 (C:) Aphrodisin, a sex pheromone {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}
elqgkwytiviaadnlekieeggplrfyfrhidcykncsemeitfyvitnnqcskttvig
ylkgngtyetqfegnnifqplyitsdkifftnknmdragqetnmivvagkgnaltpeene
ilvqfahekkipvenilnilatdtcpe

SCOPe Domain Coordinates for d1e5pc_ are not available.

Timeline for d1e5pc_:

Domains from other chains:
(mouse over for more information)
d1e5pa_, d1e5pb_, d1e5pd_