SCOPe 2.05: Domain d1e5pb_: 1e5p B:

Lineage for d1e5pb_ (1e5p B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Aphrodisin, a sex pheromone [63805] (1 species)

7. Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [63806] (1 PDB entry)

8. Domain d1e5pb_: 1e5p B: [59273]

Details for d1e5pb_

PDB Entry: 1e5p, 1.63 Å

PDB Description: crystal structure of aphrodisin, a sex pheromone from female hamster

PDB Compounds: (B:) aphrodisin

SCOPe Domain Sequences for d1e5pb_:

Sequence; same for both SEQRES and ATOM records:

>d1e5pb_ b.60.1.1 (B:) Aphrodisin, a sex pheromone {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}
aelqgkwytiviaadnlekieeggplrfyfrhidcykncsemeitfyvitnnqcskttvi
gylkgngtyetqfegnnifqplyitsdkifftnknmdragqetnmivvagkgnaltpeen
eilvqfahekkipvenilnilatdtcpe

Timeline for d1e5pb_:

• d1e5pb_ first appeared in SCOP 1.57
  
• d1e5pb_ appears in SCOPe 2.04
  
• d1e5pb_ appears in SCOPe 2.06
  
• d1e5pb_ appears in the current release, SCOPe 2.08