Lineage for d1e5pa_ (1e5p A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2413761Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2413778Protein Aphrodisin, a sex pheromone [63805] (1 species)
  7. 2413779Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [63806] (1 PDB entry)
  8. 2413780Domain d1e5pa_: 1e5p A: [59272]

Details for d1e5pa_

PDB Entry: 1e5p (more details), 1.63 Å

PDB Description: crystal structure of aphrodisin, a sex pheromone from female hamster
PDB Compounds: (A:) aphrodisin

SCOPe Domain Sequences for d1e5pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5pa_ b.60.1.1 (A:) Aphrodisin, a sex pheromone {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}
faelqgkwytiviaadnlekieeggplrfyfrhidcykncsemeitfyvitnnqcskttv
igylkgngtyetqfegnnifqplyitsdkifftnknmdragqetnmivvagkgnaltpee
neilvqfahekkipvenilnilatdtcpe

SCOPe Domain Coordinates for d1e5pa_:

Click to download the PDB-style file with coordinates for d1e5pa_.
(The format of our PDB-style files is described here.)

Timeline for d1e5pa_: