Lineage for d1e5fa_ (1e5f A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131439Family c.67.1.3: Cystathionine synthase-like [53402] (17 protein domains)
  6. 2131568Protein Methionine gamma-lyase, MGL [64126] (4 species)
  7. 2131596Species Trichomonas vaginalis, MGL1 [TaxId:5722] [64127] (2 PDB entries)
  8. 2131597Domain d1e5fa_: 1e5f A: [59267]
    complexed with gol, plp, so4

Details for d1e5fa_

PDB Entry: 1e5f (more details), 2.18 Å

PDB Description: methionine gamma-lyase (mgl) from trichomonas vaginalis
PDB Compounds: (A:) methionine gamma-lyase

SCOPe Domain Sequences for d1e5fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5fa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]}
ermtpatacihanpqkdqfgaaippiyqtstfvfdncqqggnrfagqesgyiytrlgnpt
vsnlegkiaflekteacvatssgmgaiaatvltilkagdhlisdeclygcthalfehalt
kfgiqvdfintaipgevkkhmkpntkivyfetpanptlkiidmervckdahsqegvlvia
dntfcspmitnpvdfgvdvvvhsatkyinghtdvvaglicgkadllqqirmvgikditgs
visphdawlitrglstlnirmkaesenamkvaeylkshpavekvyypgfedheghdiakk
qmrmygsmitfilksgfegakklldnlklitlavslggcesliqhpasmthavvpkeere
aagitdgmirlsvgiedadeliadfkqgldall

SCOPe Domain Coordinates for d1e5fa_:

Click to download the PDB-style file with coordinates for d1e5fa_.
(The format of our PDB-style files is described here.)

Timeline for d1e5fa_: