Lineage for d1e5ba_ (1e5b A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377026Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2377027Family b.2.2.1: Cellulose-binding domain family II [49385] (3 proteins)
    automatically mapped to Pfam PF00553
  6. 2377028Protein Endo-1,4-beta xylanase D, xylan binding domain, XBD [49388] (1 species)
    belongs to subfamily IIb
  7. 2377029Species Cellulomonas fimi [TaxId:1708] [49389] (6 PDB entries)
  8. 2377031Domain d1e5ba_: 1e5b A: [59263]
    XBD1
    mutant

Details for d1e5ba_

PDB Entry: 1e5b (more details)

PDB Description: internal xylan binding domain from c. fimi xyn10a, r262g mutant
PDB Compounds: (A:) xylanase d

SCOPe Domain Sequences for d1e5ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5ba_ b.2.2.1 (A:) Endo-1,4-beta xylanase D, xylan binding domain, XBD {Cellulomonas fimi [TaxId: 1708]}
tgcsvtatraeewsdgfnvtysvsgssawtvnlalngsqtiqaswnanvtgsgstrtvtp
ngsgntfgvtvmkngssttpaatcags

SCOPe Domain Coordinates for d1e5ba_:

Click to download the PDB-style file with coordinates for d1e5ba_.
(The format of our PDB-style files is described here.)

Timeline for d1e5ba_: