Lineage for d1e57c_ (1e57 C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1334432Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1334633Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 1335030Family b.121.4.6: Tymoviridae-like VP [88641] (2 proteins)
    automatically mapped to Pfam PF00983
  6. 1335031Protein Tymovirus coat protein [88642] (3 species)
  7. 1335036Species PHMV (Physalis mottle virus) [TaxId:72539] [49642] (2 PDB entries)
  8. 1335039Domain d1e57c_: 1e57 C: [59261]

Details for d1e57c_

PDB Entry: 1e57 (more details), 3.2 Å

PDB Description: physalis mottle virus: empty capsid
PDB Compounds: (C:) physalis mottle virus

SCOPe Domain Sequences for d1e57c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e57c_ b.121.4.6 (C:) Tymovirus coat protein {PHMV (Physalis mottle virus) [TaxId: 72539]}
kqasipapgsilsqpnteqspaivlpfqfeattfgtaetaaqvslqtadpitkltapyrh
aqiveckailtptdlavsnpltvylawvpanspatptqilrvyggqsfvlggaisaakti
evplnldsvnrmlkdsvtytdtpkllaysraptnpskiptasiqisgrirlskpmlian

SCOPe Domain Coordinates for d1e57c_:

Click to download the PDB-style file with coordinates for d1e57c_.
(The format of our PDB-style files is described here.)

Timeline for d1e57c_: