SCOPe 2.04: Domain d1e57b_: 1e57 B:

Lineage for d1e57b_ (1e57 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.6: Tymoviridae-like VP [88641] (2 proteins)
   automatically mapped to Pfam PF00983

6. Protein Tymovirus coat protein [88642] (3 species)

7. Species PHMV (Physalis mottle virus) [TaxId:72539] [49642] (2 PDB entries)

8. Domain d1e57b_: 1e57 B: [59260]

Details for d1e57b_

PDB Entry: 1e57, 3.2 Å

PDB Description: physalis mottle virus: empty capsid

PDB Compounds: (B:) physalis mottle virus

SCOPe Domain Sequences for d1e57b_:

Sequence; same for both SEQRES and ATOM records:

>d1e57b_ b.121.4.6 (B:) Tymovirus coat protein {PHMV (Physalis mottle virus) [TaxId: 72539]}
vvkvkqasipapgsilsqpnteqspaivlpfqfeattfgtaetaaqvslqtadpitklta
pyrhaqiveckailtptdlavsnpltvylawvpanspatptqilrvyggqsfvlggaisa
aktievplnldsvnrmlkdsvtytdtpkllaysraptnpskiptasiqisgrirlskpml
ian

Timeline for d1e57b_:

• d1e57b_ first appeared in SCOP 1.57
  
• d1e57b_ appears in SCOPe 2.03
  
• d1e57b_ appears in SCOPe 2.05
  
• d1e57b_ appears in the current release, SCOPe 2.08