Lineage for d1e54a_ (1e54 A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2627486Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2627626Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2627627Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. 2627628Protein Porin [56937] (5 species)
  7. 2627629Species Comamonas acidovorans [TaxId:80866] [64534] (1 PDB entry)
    Anion-selective porin OMP32
  8. 2627630Domain d1e54a_: 1e54 A: [59258]
    complexed with a periplasmic peptide, chain B
    complexed with ca, so4

Details for d1e54a_

PDB Entry: 1e54 (more details), 2.1 Å

PDB Description: anion-selective porin from comamonas acidovorans
PDB Compounds: (A:) outer membrane porin protein 32

SCOPe Domain Sequences for d1e54a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e54a_ f.4.3.1 (A:) Porin {Comamonas acidovorans [TaxId: 80866]}
essvtlfgivdtnvayvnkdaagdsryglgtsgastsrlglrgtedlggglkagfwlege
ifgddgnasgfnfkrrstvslsgnfgevrlgrdlvptsqkltsydlfsatgigpfmgfrn
waagqgaddngirannlisyytpnfggfnagfgyafdekqtigtadsvgryiggyvaydn
gplsaslglaqqktavgglatdrdeitlgasynfgvaklsgllqqtkfkrdiggdiktns
ymlgasapvggvgevklqyalydqkaidskahqitlgyvhnlskrtalygnlaflknkda
stlglqakgvyaggvqagesqtgvqvgirhaf

SCOPe Domain Coordinates for d1e54a_:

Click to download the PDB-style file with coordinates for d1e54a_.
(The format of our PDB-style files is described here.)

Timeline for d1e54a_: