![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) |
![]() | Superfamily f.4.3: Porins [56935] (5 families) ![]() |
![]() | Family f.4.3.1: Porin [56936] (2 proteins) trimer, one subunit folds into (16,20) barrel |
![]() | Protein Porin [56937] (5 species) |
![]() | Species Comamonas acidovorans [TaxId:80866] [64534] (1 PDB entry) Anion-selective porin OMP32 |
![]() | Domain d1e54a_: 1e54 A: [59258] complexed with a periplasmic peptide, chain B complexed with ca, so4 |
PDB Entry: 1e54 (more details), 2.1 Å
SCOPe Domain Sequences for d1e54a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e54a_ f.4.3.1 (A:) Porin {Comamonas acidovorans [TaxId: 80866]} essvtlfgivdtnvayvnkdaagdsryglgtsgastsrlglrgtedlggglkagfwlege ifgddgnasgfnfkrrstvslsgnfgevrlgrdlvptsqkltsydlfsatgigpfmgfrn waagqgaddngirannlisyytpnfggfnagfgyafdekqtigtadsvgryiggyvaydn gplsaslglaqqktavgglatdrdeitlgasynfgvaklsgllqqtkfkrdiggdiktns ymlgasapvggvgevklqyalydqkaidskahqitlgyvhnlskrtalygnlaflknkda stlglqakgvyaggvqagesqtgvqvgirhaf
Timeline for d1e54a_: