Lineage for d1e54a_ (1e54 A:)

  1. Root: SCOP 1.59
  2. 141686Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 142268Fold f.4: Transmembrane beta-barrels [56924] (4 superfamilies)
  4. 142293Superfamily f.4.3: Porins [56935] (3 families) (S)
  5. 142294Family f.4.3.1: Porin [56936] (1 protein)
  6. 142295Protein Porin [56937] (5 species)
  7. 142296Species Comamonas acidovorans [TaxId:80866] [64534] (1 PDB entry)
  8. 142297Domain d1e54a_: 1e54 A: [59258]

Details for d1e54a_

PDB Entry: 1e54 (more details), 2.1 Å

PDB Description: anion-selective porin from comamonas acidovorans

SCOP Domain Sequences for d1e54a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e54a_ f.4.3.1 (A:) Porin {Comamonas acidovorans}
essvtlfgivdtnvayvnkdaagdsryglgtsgastsrlglrgtedlggglkagfwlege
ifgddgnasgfnfkrrstvslsgnfgevrlgrdlvptsqkltsydlfsatgigpfmgfrn
waagqgaddngirannlisyytpnfggfnagfgyafdekqtigtadsvgryiggyvaydn
gplsaslglaqqktavgglatdrdeitlgasynfgvaklsgllqqtkfkrdiggdiktns
ymlgasapvggvgevklqyalydqkaidskahqitlgyvhnlskrtalygnlaflknkda
stlglqakgvyaggvqagesqtgvqvgirhaf

SCOP Domain Coordinates for d1e54a_:

Click to download the PDB-style file with coordinates for d1e54a_.
(The format of our PDB-style files is described here.)

Timeline for d1e54a_: