SCOPe 2.07: Domain d1e52b_: 1e52 B:

Lineage for d1e52b_ (1e52 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.9: C-terminal UvrC-binding domain of UvrB [46600] (1 family)

5. Family a.2.9.1: C-terminal UvrC-binding domain of UvrB [46601] (1 protein)

6. Protein C-terminal UvrC-binding domain of UvrB [46602] (1 species)

7. Species Escherichia coli [TaxId:562] [46603] (2 PDB entries)

8. Domain d1e52b_: 1e52 B: [59257]

Details for d1e52b_

PDB Entry: 1e52

PDB Description: solution structure of escherichia coli uvrb c-terminal domain

PDB Compounds: (B:) excinuclease abc subunit

SCOPe Domain Sequences for d1e52b_:

Sequence; same for both SEQRES and ATOM records:

>d1e52b_ a.2.9.1 (B:) C-terminal UvrC-binding domain of UvrB {Escherichia coli [TaxId: 562]}
lepdnvpmdmspkalqqkiheleglmmqhaqnlefeeaaqirdqlhqlrelfiaas

Timeline for d1e52b_:

• d1e52b_ first appeared in SCOP 1.57
  
• d1e52b_ appears in SCOPe 2.06
  
• d1e52b_ appears in the current release, SCOPe 2.08