Lineage for d1e51b_ (1e51 B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65283Superfamily c.1.10: Aldolase [51569] (4 families) (S)
  5. 65436Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (1 protein)
  6. 65437Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (4 species)
  7. 65453Species Human (Homo sapiens) [TaxId:9606] [63921] (1 PDB entry)
  8. 65455Domain d1e51b_: 1e51 B: [59255]

Details for d1e51b_

PDB Entry: 1e51 (more details), 2.83 Å

PDB Description: crystal structure of native human erythrocyte 5-aminolaevulinic acid dehydratase

SCOP Domain Sequences for d1e51b_:

Sequence, based on SEQRES records: (download)

>d1e51b_ c.1.10.3 (B:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens)}
mqpqsvlhsgyfhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkr
leemlrplveeglrcvlifgvpsrvpkdergsaadseespaieaihllrktfpnllvacd
vclcpytshghcgllsengafraeesrqrlaevalayakagcqvvapsdmmdgrveaike
almahglgnrvsvmsysakfascfygpfrdaaksspafgdrrcyqlppgarglalravdr
dvregadmlmvkpgmpyldivrevkdkhpdlplavyhvsgefamlwhgaqagafdlkaav
leamtafrragadiiityytpqllqwlk

Sequence, based on observed residues (ATOM records): (download)

>d1e51b_ c.1.10.3 (B:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens)}
mqpqsvlhsgyfhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkr
leemlrplveeglrcvlifgvpsrvpkdadseespaieaihllrktfpnllvacdvclcp
yaeesrqrlaevalayakagcqvvapsdmmdgrveaikealmahglgnrvsvmsysakfa
scfygpfrdaarrcyqlppgarglalravdrdvregadmlmvkpgmpyldivrevkdkhp
dlplavyhvsgefamlwhgaqagafdlkaavleamtafrragadiiityytpqllqwlk

SCOP Domain Coordinates for d1e51b_:

Click to download the PDB-style file with coordinates for d1e51b_.
(The format of our PDB-style files is described here.)

Timeline for d1e51b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e51a_