Lineage for d1e51a_ (1e51 A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 306689Superfamily c.1.10: Aldolase [51569] (5 families) (S)
    Common fold covers whole protein structure
  5. 306897Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (1 protein)
    hybrid of classes I and II aldolase
  6. 306898Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (4 species)
  7. 306919Species Human (Homo sapiens) [TaxId:9606] [63921] (1 PDB entry)
  8. 306920Domain d1e51a_: 1e51 A: [59254]

Details for d1e51a_

PDB Entry: 1e51 (more details), 2.83 Å

PDB Description: crystal structure of native human erythrocyte 5-aminolaevulinic acid dehydratase

SCOP Domain Sequences for d1e51a_:

Sequence, based on SEQRES records: (download)

>d1e51a_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens)}
mqpqsvlhsgyfhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkr
leemlrplveeglrcvlifgvpsrvpkdergsaadseespaieaihllrktfpnllvacd
vclcpytshghcgllsengafraeesrqrlaevalayakagcqvvapsdmmdgrveaike
almahglgnrvsvmsysakfascfygpfrdaaksspafgdrrcyqlppgarglalravdr
dvregadmlmvkpgmpyldivrevkdkhpdlplavyhvsgefamlwhgaqagafdlkaav
leamtafrragadiiityytpqllqwlk

Sequence, based on observed residues (ATOM records): (download)

>d1e51a_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens)}
mqpqsvlhsgyfhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkr
leemlrplveeglrcvlifgvpsrvpkdergsaadseespaieaihllrktfpnllvacd
vclcpytshghcgllsgafraeesrqrlaevalayakagcqvvapsdmmdgrveaikeal
mahglgnrvsvmsysakfascfygpfrdaaksspafgdrrcyqlppgarglalravdrdv
regadmlmvkpgmpyldivrevkdkhpdlplavyhvsgefamlwhgaqagafdlkaavle
amtafrragadiiityytpqllqwlk

SCOP Domain Coordinates for d1e51a_:

Click to download the PDB-style file with coordinates for d1e51a_.
(The format of our PDB-style files is described here.)

Timeline for d1e51a_: