SCOPe 2.03: Domain d1e4wh1: 1e4w H:1-110

Lineage for d1e4wh1 (1e4w H:1-110)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (177 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d1e4wh1: 1e4w H:1-110 [59232]
   Other proteins in same PDB: d1e4wh2, d1e4wl1, d1e4wl2
   part of anti-TGFalpha Fab TAB2
   complexed with cl, ni

Details for d1e4wh1

PDB Entry: 1e4w, 1.95 Å

PDB Description: crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment

PDB Compounds: (H:) tab2

SCOPe Domain Sequences for d1e4wh1:

Sequence; same for both SEQRES and ATOM records:

>d1e4wh1 b.1.1.1 (H:1-110) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqpgaelvkpgasvklsckasgftftnywmhwvkqrpgqglewigeilpsngrtny
nekfktkatltvdkssntaymqlssltsedsavyycarspsdywgqgttltvss

Timeline for d1e4wh1:

• d1e4wh1 first appeared in SCOP 1.57
  
• d1e4wh1 appears in SCOPe 2.02
  
• d1e4wh1 appears in SCOPe 2.04
  
• d1e4wh1 appears in the current release, SCOPe 2.08