Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species Anti-TGFalpha Fab TAB2, (mouse), kappa L chain [63644] (2 PDB entries) |
Domain d1e4wh1: 1e4w H:1-110 [59232] Other proteins in same PDB: d1e4wh2, d1e4wl2 |
PDB Entry: 1e4w (more details), 1.95 Å
SCOP Domain Sequences for d1e4wh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e4wh1 b.1.1.1 (H:1-110) Immunoglobulin (variable domains of L and H chains) {Anti-TGFalpha Fab TAB2, (mouse), kappa L chain} qvqlqqpgaelvkpgasvklsckasgftftnywmhwvkqrpgqglewigeilpsngrtny nekfktkatltvdkssntaymqlssltsedsavyycarspsdywgqgttltvss
Timeline for d1e4wh1: