SCOP 1.59: Domain d1e4wh1: 1e4w H:1-110

Lineage for d1e4wh1 (1e4w H:1-110)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Anti-TGFalpha Fab TAB2, (mouse), kappa L chain [63644] (2 PDB entries)

8. Domain d1e4wh1: 1e4w H:1-110 [59232]
   Other proteins in same PDB: d1e4wh2, d1e4wl2

Details for d1e4wh1

PDB Entry: 1e4w, 1.95 Å

PDB Description: crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment

SCOP Domain Sequences for d1e4wh1:

Sequence; same for both SEQRES and ATOM records:

>d1e4wh1 b.1.1.1 (H:1-110) Immunoglobulin (variable domains of L and H chains) {Anti-TGFalpha Fab TAB2, (mouse), kappa L chain}
qvqlqqpgaelvkpgasvklsckasgftftnywmhwvkqrpgqglewigeilpsngrtny
nekfktkatltvdkssntaymqlssltsedsavyycarspsdywgqgttltvss

Timeline for d1e4wh1:

• d1e4wh1 first appeared in SCOP 1.57
  
• d1e4wh1 appears in SCOP 1.61
  
• d1e4wh1 appears in the current release, SCOPe 2.08