Lineage for d1e4qa_ (1e4q A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890710Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 890711Superfamily g.9.1: Defensin-like [57392] (3 families) (S)
  5. 890712Family g.9.1.1: Defensin [57393] (10 proteins)
  6. 890726Protein Beta-defensin, BD [63384] (7 species)
  7. 890738Species Human (Homo sapiens), HBD2 [TaxId:9606] [63385] (4 PDB entries)
  8. 890759Domain d1e4qa_: 1e4q A: [59227]

Details for d1e4qa_

PDB Entry: 1e4q (more details)

PDB Description: solution structure of the human defensin hbd-2
PDB Compounds: (A:) beta-defensin 2

SCOP Domain Sequences for d1e4qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4qa_ g.9.1.1 (A:) Beta-defensin, BD {Human (Homo sapiens), HBD2 [TaxId: 9606]}
pvtclksgaichpvfcprrykqigtcglpgtkcckkp

SCOP Domain Coordinates for d1e4qa_:

Click to download the PDB-style file with coordinates for d1e4qa_.
(The format of our PDB-style files is described here.)

Timeline for d1e4qa_: