Lineage for d1e4ia_ (1e4i A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins)
  6. Protein Beta-glucosidase A [51528] (10 species)
  7. Species Bacillus polymyxa [TaxId:1406] [51529] (7 PDB entries)
  8. Domain d1e4ia_: 1e4i A: [59225]
    complexed with g2f, nfg

Details for d1e4ia_

PDB Entry: 1e4i (more details), 2 Å

PDB Description: 2-deoxy-2-fluoro-beta-d-glucosyl/enzyme intermediate complex of the beta-glucosidase from bacillus polymyxa
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d1e4ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]}
tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
eedirlmkelgirtyrfsvswprifpngdgevnqkgldyyhrvvdllndngiepfctlyh
wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf
rtqvrtpkqsyywyrnvvsnnwletrr

SCOPe Domain Coordinates for d1e4ia_ are not available.

Timeline for d1e4ia_: