Lineage for d1e4eb1 (1e4e B:2-131)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121291Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)
  4. 121292Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) (S)
  5. 121384Family c.30.1.2: D-Alanine ligase N-terminal domain [52452] (2 proteins)
  6. 121390Protein D-alanine:D-lactate ligase, VanA [52455] (2 species)
  7. 121391Species Enterococcus faecium [TaxId:1352] [63983] (1 PDB entry)
  8. 121393Domain d1e4eb1: 1e4e B:2-131 [59223]
    Other proteins in same PDB: d1e4ea2, d1e4eb2

Details for d1e4eb1

PDB Entry: 1e4e (more details), 2.5 Å

PDB Description: d-alanyl-d-lacate ligase

SCOP Domain Sequences for d1e4eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4eb1 c.30.1.2 (B:2-131) D-alanine:D-lactate ligase, VanA {Enterococcus faecium}
nrikvailfggcseehdvsvksaieiaaninkekyeplyigitksgvwkmcekpcaewen
encysavlspdkkmhgllvkknheyeinhvdvafsalhgksgedgsiqglfelsgipfvg
cdiqssaicm

SCOP Domain Coordinates for d1e4eb1:

Click to download the PDB-style file with coordinates for d1e4eb1.
(The format of our PDB-style files is described here.)

Timeline for d1e4eb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e4eb2