SCOP 1.57: Domain d1e4ea1: 1e4e A:2-131

Lineage for d1e4ea1 (1e4e A:2-131)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)

4. Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families)

5. Family c.30.1.2: D-Alanine ligase N-terminal domain [52452] (2 proteins)

6. Protein D-alanine:D-lactate ligase, VanA [52455] (2 species)

7. Species Enterococcus faecium [TaxId:1352] [63983] (1 PDB entry)

8. Domain d1e4ea1: 1e4e A:2-131 [59221]
   Other proteins in same PDB: d1e4ea2, d1e4eb2

Details for d1e4ea1

PDB Entry: 1e4e, 2.5 Å

PDB Description: d-alanyl-d-lacate ligase

SCOP Domain Sequences for d1e4ea1:

Sequence; same for both SEQRES and ATOM records:

>d1e4ea1 c.30.1.2 (A:2-131) D-alanine:D-lactate ligase, VanA {Enterococcus faecium}
nrikvailfggcseehdvsvksaieiaaninkekyeplyigitksgvwkmcekpcaewen
encysavlspdkkmhgllvkknheyeinhvdvafsalhgksgedgsiqglfelsgipfvg
cdiqssaicm

Timeline for d1e4ea1:

• d1e4ea1 is new in SCOP 1.57
  
• d1e4ea1 appears in SCOP 1.59
  
• d1e4ea1 appears in the current release, SCOPe 2.08