Lineage for d1e43a1 (1e43 A:394-483)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) 
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (11 proteins) 
Protein Bacterial alpha-Amylase [51013] (4 species) Species Bacillus licheniformis [TaxId:1402] [51014] (7 PDB entries) 
Domain d1e43a1: 1e43 A:394-483 [59217]
Other proteins in same PDB: d1e43a2
Details for d1e43a1
PDB Entry: 1e43 (more details), 1.7 Å
PDB Description: native structure of chimaeric amylase from b. amyloliquefaciens and b. licheniformis at 1.7a
SCOP Domain Sequences for d1e43a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e43a1 b.71.1.1 (A:394-483) Bacterial alpha-Amylase {Bacillus licheniformis}
yaygaqhdyfdhhdivgwtregdssvansglaalitdgpggakrmyvgrqnagetwhdit
gnrsepvvinsegwgefhvnggsvsiyvqr
SCOP Domain Coordinates for d1e43a1:
Click to download the PDB-style file with coordinates for d1e43a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e43a1:
- d1e43a1 is new in SCOP 1.57
- d1e43a1 appears in SCOP 1.59
- d1e43a1 appears in the current release, SCOPe 2.08
View in 3D
