Lineage for d1e3va_ (1e3v A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 408884Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 409086Superfamily d.17.4: NTF2-like [54427] (10 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 409166Family d.17.4.3: Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54434] (1 protein)
  6. 409167Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 409185Species Pseudomonas putida [TaxId:303] [54437] (14 PDB entries)
  8. 409191Domain d1e3va_: 1e3v A: [59205]

Details for d1e3va_

PDB Entry: 1e3v (more details), 2 Å

PDB Description: crystal structure of ketosteroid isomerase from psedomonas putida complexed with deoxycholate

SCOP Domain Sequences for d1e3va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3va_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida}
nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws
evnlsvre

SCOP Domain Coordinates for d1e3va_:

Click to download the PDB-style file with coordinates for d1e3va_.
(The format of our PDB-style files is described here.)

Timeline for d1e3va_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e3vb_