Lineage for d1e3oc1 (1e3o C:104-160)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1720412Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 1720537Protein Oct-1 POU Homeodomain [46699] (1 species)
  7. 1720538Species Human (Homo sapiens) [TaxId:9606] [46700] (7 PDB entries)
  8. 1720539Domain d1e3oc1: 1e3o C:104-160 [59197]
    Other proteins in same PDB: d1e3oc2

Details for d1e3oc1

PDB Entry: 1e3o (more details), 1.9 Å

PDB Description: crystal structure of oct-1 pou dimer bound to more
PDB Compounds: (C:) octamer-binding transcription factor 1

SCOPe Domain Sequences for d1e3oc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]}
krtsietnirvaleksfmenqkptseditliaeqlnmekevirvwfsnrrqkekrin

SCOPe Domain Coordinates for d1e3oc1:

Click to download the PDB-style file with coordinates for d1e3oc1.
(The format of our PDB-style files is described here.)

Timeline for d1e3oc1: