Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein Oct-1 POU Homeodomain [46699] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [46700] (7 PDB entries) |
Domain d1e3oc1: 1e3o C:104-160 [59197] Other proteins in same PDB: d1e3oc2 |
PDB Entry: 1e3o (more details), 1.9 Å
SCOPe Domain Sequences for d1e3oc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} krtsietnirvaleksfmenqkptseditliaeqlnmekevirvwfsnrrqkekrin
Timeline for d1e3oc1: