Lineage for d1e3ka_ (1e3k A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
  4. 50845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 50846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (14 proteins)
  6. 50903Protein Progesterone receptor [48517] (1 species)
  7. 50904Species Human (Homo sapiens) [TaxId:9606] [48518] (2 PDB entries)
  8. 50907Domain d1e3ka_: 1e3k A: [59193]

Details for d1e3ka_

PDB Entry: 1e3k (more details), 2.8 Å

PDB Description: human progesteron receptor ligand binding domain in complex with the ligand metribolone (r1881)

SCOP Domain Sequences for d1e3ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3ka_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens)}
qlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrn
lhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltm
wqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqk
gvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkil
agmvkpllfhk

SCOP Domain Coordinates for d1e3ka_:

Click to download the PDB-style file with coordinates for d1e3ka_.
(The format of our PDB-style files is described here.)

Timeline for d1e3ka_: