Lineage for d1e3da_ (1e3d A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624627Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2624628Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2624629Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 2624630Protein Nickel-iron hydrogenase, small subunit [56772] (5 species)
  7. 2624633Species Desulfovibrio desulfuricans [TaxId:876] [64510] (1 PDB entry)
  8. 2624634Domain d1e3da_: 1e3d A: [59188]
    Other proteins in same PDB: d1e3db_, d1e3dd_
    complexed with f3s, fne, fsx, h2s, mg, sf4

Details for d1e3da_

PDB Entry: 1e3d (more details), 1.8 Å

PDB Description: [nife] hydrogenase from desulfovibrio desulfuricans atcc 27774
PDB Compounds: (A:) [nife] hydrogenase small subunit

SCOPe Domain Sequences for d1e3da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3da_ e.19.1.1 (A:) Nickel-iron hydrogenase, small subunit {Desulfovibrio desulfuricans [TaxId: 876]}
srpsvvylhaaectgcseallrtyqpfidtlildtisldyhetimaaageaaeealqaav
ngpdgficlvegaiptgmdnkygyiaghtmydicknilpkakavvsigtcacyggiqaak
pnptaakgindcyadlgvkainvpgcppnplnmvgtlvaflkgqkieldevgrpvmffgq
svhdlcerrkhfdagefapsfnseearkgwclydvgckgpetynncpkvlfnetnwpvaa
ghpcigcsepnfwddmtpfyqn

SCOPe Domain Coordinates for d1e3da_:

Click to download the PDB-style file with coordinates for d1e3da_.
(The format of our PDB-style files is described here.)

Timeline for d1e3da_: