Lineage for d1e3cp_ (1e3c P:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 74262Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
  4. 74263Superfamily c.76.1: Alkaline phosphatase-like [53649] (3 families) (S)
  5. 74311Family c.76.1.2: Arylsulfatase [53653] (2 protein domains)
  6. 74312Protein Arylsulfatase A [53654] (1 species)
  7. 74313Species Human (Homo sapiens) [TaxId:9606] [53655] (5 PDB entries)
  8. 74318Domain d1e3cp_: 1e3c P: [59187]

Details for d1e3cp_

PDB Entry: 1e3c (more details), 2.65 Å

PDB Description: crystal structure of an arylsulfatase a mutant c69s soaked in synthetic substrate

SCOP Domain Sequences for d1e3cp_:

Sequence, based on SEQRES records: (download)

>d1e3cp_ c.76.1.2 (P:) Arylsulfatase A {Human (Homo sapiens)}
rppnivlifaddlgygdlgcyghpssttpnldqlaagglrftdfyvpvslstpsraallt
grlpvrmgmypgvlvpssrgglpleevtvaevlaargyltgmagkwhlgvgpegaflpph
qgfhrflgipyshdqgpcqnltcfppatpcdggcdqglvpipllanlsveaqppwlpgle
arymafahdlmadaqredrpfflyyashhthypqfsgqsfaersgrgpfgdslmeldaav
gtlmtaigdlglleetlviftadngpetmrmsrggcsgllrcgkgttyeggvrepalafw
pghiapgvthelassldllptlaalagaplpnvtldgfdlsplllgtgksprqslffyps
ypdevrgvfavrtgkykahfftqgsahsdttadpachasssltaheppllydlskdpgen
ynllggvagatpevlqalkqlqllkaqldaavtfgpsqvargedpalqicchpgctprpa
cchcp

Sequence, based on observed residues (ATOM records): (download)

>d1e3cp_ c.76.1.2 (P:) Arylsulfatase A {Human (Homo sapiens)}
rppnivlifaddlgygdlgcyghpssttpnldqlaagglrftdfyvpvslstpsraallt
grlpvrmgmypgvlvpssrgglpleevtvaevlaargyltgmagkwhlgvgpegaflpph
qgfhrflgipyshdqgpcqnltcfppatpcdggcdqglvpipllanlsveaqppwlpgle
arymafahdlmadaqredrpfflyyashhthypqfsgqsfaersgrgpfgdslmeldaav
gtlmtaigdlglleetlviftadngpetmrmsrggcsgllrcgkgttyeggvrepalafw
pghiapgvthelassldllptlaalagaplpnvtldgfdlsplllgtgksprqslffyps
ypdevrgvfavrtgkykahfftqgsahsdttadpachasssltaheppllydlskdpgen
ynllgatpevlqalkqlqllkaqldaavtfgpsqvargedpalqicchpgctprpacchc
p

SCOP Domain Coordinates for d1e3cp_:

Click to download the PDB-style file with coordinates for d1e3cp_.
(The format of our PDB-style files is described here.)

Timeline for d1e3cp_: