Lineage for d1e33p_ (1e33 P:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138453Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2138454Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2138572Family c.76.1.2: Arylsulfatase [53653] (4 protein domains)
    includes additional C-terminal alpha+beta (sub)domain
  6. 2138573Protein Arylsulfatase A [53654] (1 species)
  7. 2138574Species Human (Homo sapiens) [TaxId:9606] [53655] (7 PDB entries)
  8. 2138579Domain d1e33p_: 1e33 P: [59186]
    complexed with mg; mutant

Details for d1e33p_

PDB Entry: 1e33 (more details), 2.5 Å

PDB Description: crystal structure of an arylsulfatase a mutant p426l
PDB Compounds: (P:) arylsulfatase a

SCOPe Domain Sequences for d1e33p_:

Sequence, based on SEQRES records: (download)

>d1e33p_ c.76.1.2 (P:) Arylsulfatase A {Human (Homo sapiens) [TaxId: 9606]}
rppnivlifaddlgygdlgcyghpssttpnldqlaagglrftdfyvpvslxtpsraallt
grlpvrmgmypgvlvpssrgglpleevtvaevlaargyltgmagkwhlgvgpegaflpph
qgfhrflgipyshdqgpcqnltcfppatpcdggcdqglvpipllanlsveaqppwlpgle
arymafahdlmadaqredrpfflyyashhthypqfsgqsfaersgrgpfgdslmeldaav
gtlmtaigdlglleetlviftadngpetmrmsrggcsgllrcgkgttyeggvrepalafw
pghiapgvthelassldllptlaalagaplpnvtldgfdlsplllgtgksprqslffyps
ypdevrgvfavrtgkykahfftqgsahsdttadpachasssltaheplllydlskdpgen
ynllggvagatpevlqalkqlqllkaqldaavtfgpsqvargedpalqicchpgctprpa
cchcp

Sequence, based on observed residues (ATOM records): (download)

>d1e33p_ c.76.1.2 (P:) Arylsulfatase A {Human (Homo sapiens) [TaxId: 9606]}
rppnivlifaddlgygdlgcyghpssttpnldqlaagglrftdfyvpvslxtpsraallt
grlpvrmgmypgvlvpssrgglpleevtvaevlaargyltgmagkwhlgvgpegaflpph
qgfhrflgipyshdqgpcqnltcfppatpcdggcdqglvpipllanlsveaqppwlpgle
arymafahdlmadaqredrpfflyyashhthypqfsgqsfaersgrgpfgdslmeldaav
gtlmtaigdlglleetlviftadngpetmrmsrggcsgllrcgkgttyeggvrepalafw
pghiapgvthelassldllptlaalagaplpnvtldgfdlsplllgtgksprqslffyps
ypdevrgvfavrtgkykahfftqgsahsdttadpachasssltaheplllydlskdpgen
ynllgatpevlqalkqlqllkaqldaavtfgpsqvargedpalqicchpgctprpacchc
p

SCOPe Domain Coordinates for d1e33p_:

Click to download the PDB-style file with coordinates for d1e33p_.
(The format of our PDB-style files is described here.)

Timeline for d1e33p_: