Lineage for d1e32a3 (1e32 A:107-200)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins)
  6. Protein Membrane fusion atpase p97 domain 2, P97-Nc [64254] (2 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [64255] (5 PDB entries)
  8. Domain d1e32a3: 1e32 A:107-200 [59185]
    Other proteins in same PDB: d1e32a1, d1e32a2
    complexed with adp

Details for d1e32a3

PDB Entry: 1e32 (more details), 2.9 Å

PDB Description: structure of the n-terminal domain and the d1 aaa domain of membrane fusion atpase p97
PDB Compounds: (A:) p97

SCOPe Domain Sequences for d1e32a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e32a3 d.31.1.1 (A:107-200) Membrane fusion atpase p97 domain 2, P97-Nc {Mouse (Mus musculus) [TaxId: 10090]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcegepikredeeeslne

SCOPe Domain Coordinates for d1e32a3 are not available.

Timeline for d1e32a3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e32a1, d1e32a2