Lineage for d1e32a2 (1e32 A:201-458)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) 
Family c.37.1.13: Extended AAA-ATPase domain [52700] (16 proteins) 
Protein Membrane fusion atpase p97, D1 domain [64038] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [64039] (1 PDB entry) 
Domain d1e32a2: 1e32 A:201-458 [59184]
Other proteins in same PDB: d1e32a1, d1e32a3
Details for d1e32a2
PDB Entry: 1e32 (more details), 2.9 Å
PDB Description: structure of the n-terminal domain and the d1 aaa domain of membrane fusion atpase p97
SCOP Domain Sequences for d1e32a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e32a2 c.37.1.13 (A:201-458) Membrane fusion atpase p97, D1 domain {Mouse (Mus musculus)}
vgyddvggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
vmnslavtmddfrwalsq
SCOP Domain Coordinates for d1e32a2:
Click to download the PDB-style file with coordinates for d1e32a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e32a2:
- d1e32a2 first appeared in SCOP 1.57
- d1e32a2 appears in SCOP 1.61
- d1e32a2 appears in the current release, SCOPe 2.08
View in 3D
