Lineage for d1e32a1 (1e32 A:21-106)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61730Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
  4. 61744Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 61786Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (3 proteins)
  6. 61787Protein Membrane fusion atpase p97 N-terminal domain , P97-Nn [63796] (1 species)
  7. 61788Species Mouse (Mus musculus) [TaxId:10090] [63797] (1 PDB entry)
  8. 61789Domain d1e32a1: 1e32 A:21-106 [59183]
    Other proteins in same PDB: d1e32a2, d1e32a3

Details for d1e32a1

PDB Entry: 1e32 (more details), 2.9 Å

PDB Description: structure of the n-terminal domain and the d1 aaa domain of membrane fusion atpase p97

SCOP Domain Sequences for d1e32a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e32a1 b.52.2.3 (A:21-106) Membrane fusion atpase p97 N-terminal domain , P97-Nn {Mouse (Mus musculus)}
nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsde
kirmnrvvrnnlrvrlgdvisiqpcp

SCOP Domain Coordinates for d1e32a1:

Click to download the PDB-style file with coordinates for d1e32a1.
(The format of our PDB-style files is described here.)

Timeline for d1e32a1: