Lineage for d1e2yj_ (1e2y J:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877857Protein Tryparedoxin peroxidase (thioredoxin peroxidase homologue) [64064] (2 species)
  7. 2877858Species Crithidia fasciculata [TaxId:5656] [64065] (1 PDB entry)
  8. 2877868Domain d1e2yj_: 1e2y J: [59182]
    complexed with cl

Details for d1e2yj_

PDB Entry: 1e2y (more details), 3.2 Å

PDB Description: tryparedoxin peroxidase from crithidia fasciculata
PDB Compounds: (J:) tryparedoxin peroxidase

SCOPe Domain Sequences for d1e2yj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e2yj_ c.47.1.10 (J:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]}
aaklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfsddak
rfaeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvldedsg
vayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehg

SCOPe Domain Coordinates for d1e2yj_:

Click to download the PDB-style file with coordinates for d1e2yj_.
(The format of our PDB-style files is described here.)

Timeline for d1e2yj_: