Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (10 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (9 proteins) |
Protein Tryparedoxin peroxidase (thioredoxin peroxidase homologue) [64064] (1 species) |
Species Crithidia fasciculata [TaxId:5656] [64065] (1 PDB entry) |
Domain d1e2yg_: 1e2y G: [59179] |
PDB Entry: 1e2y (more details), 3.2 Å
SCOP Domain Sequences for d1e2yg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e2yg_ c.47.1.10 (G:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata} aklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfsddakr faeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvldedsgv ayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehgevcpanwk
Timeline for d1e2yg_: