Lineage for d1e2yg_ (1e2y G:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70801Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 70802Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 71226Family c.47.1.10: Glutathione peroxidase-like [52901] (9 proteins)
  6. 71273Protein Tryparedoxin peroxidase (thioredoxin peroxidase homologue) [64064] (1 species)
  7. 71274Species Crithidia fasciculata [TaxId:5656] [64065] (1 PDB entry)
  8. 71281Domain d1e2yg_: 1e2y G: [59179]

Details for d1e2yg_

PDB Entry: 1e2y (more details), 3.2 Å

PDB Description: tryparedoxin peroxidase from crithidia fasciculata

SCOP Domain Sequences for d1e2yg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e2yg_ c.47.1.10 (G:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata}
aklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfsddakr
faeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvldedsgv
ayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehgevcpanwk

SCOP Domain Coordinates for d1e2yg_:

Click to download the PDB-style file with coordinates for d1e2yg_.
(The format of our PDB-style files is described here.)

Timeline for d1e2yg_: