| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
| Protein Tryparedoxin peroxidase (thioredoxin peroxidase homologue) [64064] (2 species) |
| Species Crithidia fasciculata [TaxId:5656] [64065] (1 PDB entry) |
| Domain d1e2yd_: 1e2y D: [59176] complexed with cl |
PDB Entry: 1e2y (more details), 3.2 Å
SCOPe Domain Sequences for d1e2yd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e2yd_ c.47.1.10 (D:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]}
aaklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfsddak
rfaeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvldedsg
vayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehg
Timeline for d1e2yd_: