SCOP 1.63: Domain d1e2qa_: 1e2q A:

Lineage for d1e2qa_ (1e2q A:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Thymidylate kinase [52563] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64010] (13 PDB entries)

8. Domain d1e2qa_: 1e2q A: [59172]
   complexed with atp, mg, tmp; mutant

Details for d1e2qa_

PDB Entry: 1e2q, 1.7 Å

PDB Description: human thymidylate kinase complexed with tp5a and a magnesium-ion

SCOP Domain Sequences for d1e2qa_:

Sequence; same for both SEQRES and ATOM records:

>d1e2qa_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens)}
rrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssylqkksdv
edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdvg
lpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkmvdasks
ieavhedirvlsedaiatatekplgelwk

Timeline for d1e2qa_:

• d1e2qa_ first appeared in SCOP 1.57
  
• d1e2qa_ appears in SCOP 1.61
  
• d1e2qa_ appears in SCOP 1.65
  
• d1e2qa_ appears in the current release, SCOPe 2.08