Lineage for d1e2pa_ (1e2p A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. Protein Thymidine kinase [52552] (4 species)
    contains insert all-alpha subdomain, res. 251-322
  7. Species Herpes simplex virus type 1, different strains [TaxId:10298] [52553] (33 PDB entries)
    Uniprot P03176 46-375
  8. Domain d1e2pa_: 1e2p A: [59170]
    complexed with ccv, so4

Details for d1e2pa_

PDB Entry: 1e2p (more details), 2.5 Å

PDB Description: thymidine kinase, dhbt
PDB Compounds: (A:) Thymidine kinase

SCOPe Domain Sequences for d1e2pa_:

Sequence, based on SEQRES records: (download)

>d1e2pa_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]}
mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagsshapppaltlifdrhp
iaallcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpge
rldlamlaairrvygllantvrylqcggswredwgqlsgtavppqgaepqsnagprphig
dtlftlfrapellapngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqlts
gmvqthvttpgsipticdlartfaremge

Sequence, based on observed residues (ATOM records): (download)

>d1e2pa_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]}
mptllrvyidgphgmgkttttqllrddivyvpepmtywrvlgasetianiyttqhrldqg
eisagdaavvmtsaqitmgmpyavtdavlaphiggeagsppaltlifdrhpiaallcypa
arylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpgerldlamlaa
irrvygllantvrylqcggswredwgqlsgprphigdtlftlfrapellapngdlynvfa
waldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsipticdlartfa
remge

SCOPe Domain Coordinates for d1e2pa_ are not available.

Timeline for d1e2pa_:

Domains from other chains:
(mouse over for more information)
d1e2pb_