Lineage for d1e2na_ (1e2n A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69450Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (8 proteins)
  6. 69509Protein Thymidine kinase [52552] (1 species)
  7. 69510Species Herpes simplex virus type 1, different strains [TaxId:10298] [52553] (20 PDB entries)
  8. 69521Domain d1e2na_: 1e2n A: [59168]

Details for d1e2na_

PDB Entry: 1e2n (more details), 2.2 Å

PDB Description: hpt + hmtt

SCOP Domain Sequences for d1e2na_:

Sequence, based on SEQRES records: (download)

>d1e2na_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains}
mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagsshapppaltlifdrhp
iaallcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpge
rldlamlaairrvygllantvrylqcggswredwgqlsgtavppqgaepqsnagprphig
dtlftlfrapellapngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqlts
gmvqthvttpgsipticdlartfaremge

Sequence, based on observed residues (ATOM records): (download)

>d1e2na_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains}
mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagsppaltlifdrhpiaal
lcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpgerldl
amlaairrvygllantvrylqcggswredwgqlsgprphigdtlftlfrapellapngdl
ynvfawaldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsipticdl
artfaremge

SCOP Domain Coordinates for d1e2na_:

Click to download the PDB-style file with coordinates for d1e2na_.
(The format of our PDB-style files is described here.)

Timeline for d1e2na_: