Lineage for d1e2ea_ (1e2e A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 242913Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 243055Protein Thymidylate kinase [52563] (4 species)
  7. 243072Species Human (Homo sapiens) [TaxId:9606] [64010] (13 PDB entries)
  8. 243084Domain d1e2ea_: 1e2e A: [59163]
    complexed with adp, af3, mg, tmp; mutant

Details for d1e2ea_

PDB Entry: 1e2e (more details), 2 Å

PDB Description: human thymidylate kinase complexed with thymidine monophosphate, adenosine diphosphate,a magnesium-ion and alf3

SCOP Domain Sequences for d1e2ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e2ea_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens)}
rrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssylqkksdv
edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdvg
lpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkmvdasks
ieavhedirvlsedaiatatekplgelwk

SCOP Domain Coordinates for d1e2ea_:

Click to download the PDB-style file with coordinates for d1e2ea_.
(The format of our PDB-style files is described here.)

Timeline for d1e2ea_: