Lineage for d1e2da_ (1e2d A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) 
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (8 proteins) 
Protein Thymidylate kinase [52563] (3 species) Species Human (Homo sapiens) [TaxId:9606] [64010] (5 PDB entries) 
Domain d1e2da_: 1e2d A: [59162]
Details for d1e2da_
PDB Entry: 1e2d (more details), 1.65 Å
PDB Description: human thymidylate kinase complexed with thymidine monophosphate, adenosine diphosphate and a magnesium-ion
SCOP Domain Sequences for d1e2da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e2da_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens)}
rrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssylqkksdv
edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdvg
lpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkmvdasks
ieavhedirvlsedaiatatekplgelwk
SCOP Domain Coordinates for d1e2da_:
Click to download the PDB-style file with coordinates for d1e2da_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e2da_:
- d1e2da_ is new in SCOP 1.57
- d1e2da_ appears in SCOP 1.59
- d1e2da_ appears in the current release, SCOPe 2.08
View in 3D