Lineage for d1e29a_ (1e29 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980368Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980369Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980370Family a.3.1.1: monodomain cytochrome c [46627] (16 protein domains)
  6. 1980748Protein Photosystem II associated cytochrome c549 [63459] (2 species)
  7. 1980752Species Synechocystis sp. PCC 6803 [TaxId:1148] [63460] (1 PDB entry)
  8. 1980753Domain d1e29a_: 1e29 A: [59161]
    complexed with ca, hec

Details for d1e29a_

PDB Entry: 1e29 (more details), 1.21 Å

PDB Description: psii associated cytochrome c549 from synechocystis sp.
PDB Compounds: (A:) cytochrome c549

SCOPe Domain Sequences for d1e29a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e29a_ a.3.1.1 (A:) Photosystem II associated cytochrome c549 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
veltestrtipldeaggtttltarqftngqkifvdtctqchlqgktktnnnvslgladla
gaeprrdnvlalveflknpksydgeddyselhpnisrpdiypemrnyteddifdvagytl
iapklderwggtiyf

SCOPe Domain Coordinates for d1e29a_:

Click to download the PDB-style file with coordinates for d1e29a_.
(The format of our PDB-style files is described here.)

Timeline for d1e29a_: