SCOPe 2.06: Domain d1e0xa_: 1e0x A:

Lineage for d1e0xa_ (1e0x A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Xylanase A, catalytic core [51514] (8 species)

7. Species Streptomyces lividans [TaxId:1916] [51515] (9 PDB entries)
   Uniprot P26514 43-344

8. Domain d1e0xa_: 1e0x A: [59151]
   complexed with gol

Details for d1e0xa_

PDB Entry: 1e0x, 1.65 Å

PDB Description: xylanase 10a from sreptomyces lividans. xylobiosyl-enzyme intermediate at 1.65 a

PDB Compounds: (A:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d1e0xa_:

Sequence; same for both SEQRES and ATOM records:

>d1e0xa_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]}
aestlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfn
fssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgki
vqwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwa
ktqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gapastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldal
nggdsseppa

Timeline for d1e0xa_:

• d1e0xa_ first appeared in SCOP 1.57
  
• d1e0xa_ appears in SCOPe 2.05
  
• d1e0xa_ appears in SCOPe 2.07
  
• d1e0xa_ appears in the current release, SCOPe 2.08