Lineage for d1e0xa_ (1e0x A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64720Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) (S)
  5. 64889Family c.1.8.3: beta-glycanases [51487] (14 proteins)
  6. 65011Protein Xylanase A, catalytic core [51514] (6 species)
  7. 65037Species Streptomyces lividans [TaxId:1916] [51515] (4 PDB entries)
  8. 65039Domain d1e0xa_: 1e0x A: [59151]

Details for d1e0xa_

PDB Entry: 1e0x (more details), 1.65 Å

PDB Description: xylanase 10a from sreptomyces lividans. xylobiosyl-enzyme intermediate at 1.65 a

SCOP Domain Sequences for d1e0xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0xa_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans}
aestlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfn
fssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgki
vqwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwa
ktqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gapastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldal
nggdssepp

SCOP Domain Coordinates for d1e0xa_:

Click to download the PDB-style file with coordinates for d1e0xa_.
(The format of our PDB-style files is described here.)

Timeline for d1e0xa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e0xb_