Lineage for d1e0wa_ (1e0w A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831125Protein Xylanase A, catalytic core [51514] (8 species)
  7. 2831170Species Streptomyces lividans [TaxId:1916] [51515] (9 PDB entries)
    Uniprot P26514 43-344
  8. 2831176Domain d1e0wa_: 1e0w A: [59150]

Details for d1e0wa_

PDB Entry: 1e0w (more details), 1.2 Å

PDB Description: Xylanase 10A from Sreptomyces lividans. native structure at 1.2 angstrom resolution
PDB Compounds: (A:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d1e0wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0wa_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]}
aestlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfn
fssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgki
vqwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwa
ktqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gapastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldal
ng

SCOPe Domain Coordinates for d1e0wa_:

Click to download the PDB-style file with coordinates for d1e0wa_.
(The format of our PDB-style files is described here.)

Timeline for d1e0wa_: