Lineage for d1e0va_ (1e0v A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) 
Family c.1.8.3: beta-glycanases [51487] (14 proteins) 
Protein Xylanase A, catalytic core [51514] (6 species) 
Species Streptomyces lividans [TaxId:1916] [51515] (4 PDB entries) 
Domain d1e0va_: 1e0v A: [59149]
Details for d1e0va_
PDB Entry: 1e0v (more details), 1.7 Å
PDB Description: xylanase 10a from sreptomyces lividans. cellobiosyl-enzyme intermediate at 1.7 a
SCOP Domain Sequences for d1e0va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e0va_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans}
aestlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfn
fssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgki
vqwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwa
ktqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gapastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldal
ng
SCOP Domain Coordinates for d1e0va_:
Click to download the PDB-style file with coordinates for d1e0va_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e0va_:
- d1e0va_ is new in SCOP 1.57
- d1e0va_ appears in SCOP 1.59
- d1e0va_ appears in the current release, SCOPe 2.08
View in 3D