SCOP 1.75: Domain d1e09a_: 1e09 A:

Lineage for d1e09a_ (1e09 A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (10 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (4 proteins)

6. Protein Major tree pollen allergen [55963] (4 species)

7. Species Sweet cherry (Prunus avium), pru av 1 [TaxId:42229] [64387] (2 PDB entries)

8. Domain d1e09a_: 1e09 A: [59146]

Details for d1e09a_

PDB Entry: 1e09

PDB Description: solution structure of the major cherry allergen pru av 1

PDB Compounds: (A:) pru av 1

SCOP Domain Sequences for d1e09a_:

Sequence; same for both SEQRES and ATOM records:

>d1e09a_ d.129.3.1 (A:) Major tree pollen allergen {Sweet cherry (Prunus avium), pru av 1 [TaxId: 42229]}
gvftyeseftseippprlfkafvldadnlvpkiapqaikhseilegdggpgtikkitfge
gsqygyvkhkidsidkenysysytliegdalgdtlekisyetklvaspsggsiikstshy
htkgnveikeehvkagkekasnlfklietylkghpdayn

Timeline for d1e09a_:

• d1e09a_ first appeared in SCOP 1.57
  
• d1e09a_ appears in SCOP 1.73
  
• d1e09a_ appears in SCOPe 2.01
  
• d1e09a_ appears in the current release, SCOPe 2.08