![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (10 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (4 proteins) |
![]() | Protein Major tree pollen allergen [55963] (4 species) |
![]() | Species Sweet cherry (Prunus avium), pru av 1 [TaxId:42229] [64387] (2 PDB entries) |
![]() | Domain d1e09a_: 1e09 A: [59146] |
PDB Entry: 1e09 (more details)
SCOP Domain Sequences for d1e09a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e09a_ d.129.3.1 (A:) Major tree pollen allergen {Sweet cherry (Prunus avium), pru av 1 [TaxId: 42229]} gvftyeseftseippprlfkafvldadnlvpkiapqaikhseilegdggpgtikkitfge gsqygyvkhkidsidkenysysytliegdalgdtlekisyetklvaspsggsiikstshy htkgnveikeehvkagkekasnlfklietylkghpdayn
Timeline for d1e09a_: