Lineage for d1e09a_ (1e09 A:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.129: TBP-like [55944] (4 superfamilies) 
Superfamily d.129.3: Bet v1-like [55961] (4 families) 
Family d.129.3.1: Major tree pollen allergen [55962] (1 protein) Protein Major tree pollen allergen [55963] (3 species) 
Species Sweet cherry (Prunus avium), pru av 1 [TaxId:42229] [64387] (1 PDB entry) 
Domain d1e09a_: 1e09 A: [59146]
Details for d1e09a_
PDB Entry: 1e09 (more details)
PDB Description: solution structure of the major cherry allergen pru av 1
SCOP Domain Sequences for d1e09a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e09a_ d.129.3.1 (A:) Major tree pollen allergen {Sweet cherry (Prunus avium), pru av 1}
gvftyeseftseippprlfkafvldadnlvpkiapqaikhseilegdggpgtikkitfge
gsqygyvkhkidsidkenysysytliegdalgdtlekisyetklvaspsggsiikstshy
htkgnveikeehvkagkekasnlfklietylkghpdayn
SCOP Domain Coordinates for d1e09a_:
Click to download the PDB-style file with coordinates for d1e09a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e09a_:
- d1e09a_ is new in SCOP 1.57
- d1e09a_ appears in SCOP 1.59
- d1e09a_ appears in the current release, SCOPe 2.08
View in 3D