Class a: All alpha proteins [46456] (289 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.3: apo-D-alanyl carrier protein [63535] (1 protein) automatically mapped to Pfam PF00550 |
Protein apo-D-alanyl carrier protein [63536] (2 species) |
Species Lactobacillus casei [TaxId:1582] [63537] (2 PDB entries) |
Domain d1dv5a_: 1dv5 A: [59139] |
PDB Entry: 1dv5 (more details)
SCOPe Domain Sequences for d1dv5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dv5a_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]} adeaikngvldiladltgsddvkknldlnlfetglldsmgtvqlllelqsqfgvdapvse fdrkewdtpnkiiakveqaq
Timeline for d1dv5a_: