Lineage for d1dv5a_ (1dv5 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 354640Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 354641Superfamily a.28.1: ACP-like [47336] (3 families) (S)
  5. 354672Family a.28.1.3: apo-D-alanyl carrier protein [63535] (1 protein)
  6. 354673Protein apo-D-alanyl carrier protein [63536] (1 species)
  7. 354674Species Lactobacillus casei [TaxId:1582] [63537] (2 PDB entries)
  8. 354675Domain d1dv5a_: 1dv5 A: [59139]

Details for d1dv5a_

PDB Entry: 1dv5 (more details)

PDB Description: tertiary structure of apo-d-alanyl carrier protein

SCOP Domain Sequences for d1dv5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dv5a_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei}
adeaikngvldiladltgsddvkknldlnlfetglldsmgtvqlllelqsqfgvdapvse
fdrkewdtpnkiiakveqaq

SCOP Domain Coordinates for d1dv5a_:

Click to download the PDB-style file with coordinates for d1dv5a_.
(The format of our PDB-style files is described here.)

Timeline for d1dv5a_: