Lineage for d1dtza1 (1dtz A:1-333)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2914985Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 2914986Protein Lactoferrin [53889] (6 species)
  7. 2914987Species Camel (Camelus dromedarius) [TaxId:9838] [64195] (2 PDB entries)
  8. 2914988Domain d1dtza1: 1dtz A:1-333 [59134]

Details for d1dtza1

PDB Entry: 1dtz (more details), 2.65 Å

PDB Description: structure of camel apo-lactoferrin demonstrates its dual role in sequestering and transporting ferric ions simultaneously:crystal structure of camel apo-lactoferrin at 2.6a resolution.
PDB Compounds: (A:) apo lactoferrin

SCOPe Domain Sequences for d1dtza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dtza1 c.94.1.2 (A:1-333) Lactoferrin {Camel (Camelus dromedarius) [TaxId: 9838]}
askksvrwcttspaeskkcaqwqrrmkkvrgpsvtcvkktsrfeciqaistekadavtld
gglvydagldpyklrpiaaevygtenqpqthyyavaiakkgtnfqlnqlqglkschtglg
rsagwnipmgllrpfldwtgppeplqkavakffsascvpcvdgkeypnlcqlcagtgenk
cacssqepyfgysgafkclqdgagdvafvkdstvfeslpakadrdqyellcpnntrkpvd
afqechlarvpshavvarsvngkedliwkllvkaqekfgrgkpsafqlfgspagqkdllf
kdsalgllripkkidsglylgsnyitairglre

SCOPe Domain Coordinates for d1dtza1:

Click to download the PDB-style file with coordinates for d1dtza1.
(The format of our PDB-style files is described here.)

Timeline for d1dtza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dtza2