Lineage for d1djub_ (1dju B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 73100Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 73101Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) (S)
  5. 73102Family c.67.1.1: AAT-like [53384] (5 proteins)
  6. 73103Protein Aromatic aminoacid aminotransferase, AroAT [53392] (3 species)
  7. 73104Species Archaeon Pyrococcus horikoshii [TaxId:53953] [64120] (3 PDB entries)
  8. 73110Domain d1djub_: 1dju B: [59117]

Details for d1djub_

PDB Entry: 1dju (more details), 2.1 Å

PDB Description: crystal structure of aromatic aminotransferase from pyrococcus horikoshii ot3

SCOP Domain Sequences for d1djub_:

Sequence, based on SEQRES records: (download)

>d1djub_ c.67.1.1 (B:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii}
alsdrlelvsaseirklfdiaagmkdvislgigepdfdtpqhikeyakealdkglthygp
nigllelreaiaeklkkqngieadpkteimvllganqaflmglsaflkdgeevliptpaf
vsyapavilaggkpvevptyeedefrlnvdelkkyvtdktraliinspcnptgavltkkd
leeiadfvvehdlivisdevyehfiyddarhysiasldgmfertitvngfsktfamtgwr
lgfvaapswiiermvkfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrklv
wkrlnemglptvkpkgafyifprirdtgltskkfselmlkearvavvpgsafgkagegyv
risyatayekleeamermervlkerklv

Sequence, based on observed residues (ATOM records): (download)

>d1djub_ c.67.1.1 (B:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii}
alsdrlelvsdvislgigepdfdtpqhikeyakealdkglthygpnigllelreaiaekl
kkqngieadpkteimvllganqaflmglsaflkdgeevliptpafvsyapavilaggkpv
evptyeedefrlnvdelkkyvtdktraliinspcnptgavltkkdleeiadfvvehdliv
isdevyehfiyddarhysiasldgmfertitvngfsktfamtgwrlgfvaapswiiermv
kfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrklvwkrlnemglptvkpk
gafyifprirdtgltskkfselmlkearvavvpgsafgkagegyvrisyatayekleeam
ermervlkerklv

SCOP Domain Coordinates for d1djub_:

Click to download the PDB-style file with coordinates for d1djub_.
(The format of our PDB-style files is described here.)

Timeline for d1djub_: