Lineage for d1djua_ (1dju A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2130992Family c.67.1.1: AAT-like [53384] (17 protein domains)
  6. 2131005Protein Aromatic aminoacid aminotransferase, AroAT [53392] (4 species)
  7. 2131045Species Pyrococcus horikoshii [TaxId:53953] [64120] (3 PDB entries)
  8. 2131050Domain d1djua_: 1dju A: [59116]
    complexed with plp

Details for d1djua_

PDB Entry: 1dju (more details), 2.1 Å

PDB Description: crystal structure of aromatic aminotransferase from pyrococcus horikoshii ot3
PDB Compounds: (A:) aromatic aminotransferase

SCOPe Domain Sequences for d1djua_:

Sequence, based on SEQRES records: (download)

>d1djua_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Pyrococcus horikoshii [TaxId: 53953]}
alsdrlelvsaseirklfdiaagmkdvislgigepdfdtpqhikeyakealdkglthygp
nigllelreaiaeklkkqngieadpkteimvllganqaflmglsaflkdgeevliptpaf
vsyapavilaggkpvevptyeedefrlnvdelkkyvtdktraliinspcnptgavltkkd
leeiadfvvehdlivisdevyehfiyddarhysiasldgmfertitvngfsktfamtgwr
lgfvaapswiiermvkfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrklv
wkrlnemglptvkpkgafyifprirdtgltskkfselmlkearvavvpgsafgkagegyv
risyatayekleeamermervlkerklv

Sequence, based on observed residues (ATOM records): (download)

>d1djua_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Pyrococcus horikoshii [TaxId: 53953]}
alsdrlelvsakdvislgigepdfdtpqhikeyakealdkglthygpnigllelreaiae
klkkqngieadpkteimvllganqaflmglsaflkdgeevliptpafvsyapavilaggk
pvevptyeedefrlnvdelkkyvtdktraliinspcnptgavltkkdleeiadfvvehdl
ivisdevyehfiyddarhysiasldgmfertitvngfsktfamtgwrlgfvaapswiier
mvkfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrklvwkrlnemglptvk
pkgafyifprirdtgltskkfselmlkearvavvpgsafgkagegyvrisyatayeklee
amermervlkerklv

SCOPe Domain Coordinates for d1djua_:

Click to download the PDB-style file with coordinates for d1djua_.
(The format of our PDB-style files is described here.)

Timeline for d1djua_: