Lineage for d1d1yb_ (1d1y B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2236062Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 2236063Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 2236064Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 2236065Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 2236073Species Cow (Bos taurus) [TaxId:9913] [56517] (93 PDB entries)
    Uniprot P29473 67-482
  8. 2236179Domain d1d1yb_: 1d1y B: [59106]
    complexed with 3bt, act, cad, edo, gol, hem, zn

Details for d1d1yb_

PDB Entry: 1d1y (more details), 2.2 Å

PDB Description: bovine endothelial nitric oxide synthase heme domain complexed with 1,3-pbitu (h4b free)
PDB Compounds: (B:) bovine endothelial nitric oxide synthase heme domain

SCOPe Domain Sequences for d1d1yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1yb_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
kfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqllsq
ardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprcvg
riqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriwns
qlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfvlp
pelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigtrn
lcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaatvs
fmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

SCOPe Domain Coordinates for d1d1yb_:

Click to download the PDB-style file with coordinates for d1d1yb_.
(The format of our PDB-style files is described here.)

Timeline for d1d1yb_: